PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_69621.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 183aa    MW: 20644.3 Da    PI: 5.8808
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_69621.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.85.2e-50451702128
           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                   +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++  +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +  ++++
  MLOC_69621.1  45 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRGENSR 140
                   79***************************.89***************7777899******************************************* PP

           NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                    +glkktLvfy+g+apkg++++W+m+eyrl
  MLOC_69621.1 141 PIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 170
                   ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-5444176IPR003441NAC domain
PROSITE profilePS5100551.60944183IPR003441NAC domain
PfamPF023652.3E-2546170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MSRDIDEGSV SAATAGGGGG EVGGEPAAGV GDEAAVDSHE NDLVMPGFRF HPTEEELIEF  60
YLRRKVEGRR FNVELITFLD LYRFDPWELP AMAVIGEKEW FFYVPRDRKY RNGDRPNRVT  120
ASGYWKATGA DRMIRGENSR PIGLKKTLVF YSGKAPKGVR SSWIMNEYRL PPPTTDADLF  180
YKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-544617419146NAC domain-containing protein 19
4dul_A2e-544617419146NAC domain-containing protein 19
1ut7_B2e-544617419146NO APICAL MERISTEM PROTEIN
1ut7_A2e-544617419146NO APICAL MERISTEM PROTEIN
1ut4_B2e-544617419146NO APICAL MERISTEM PROTEIN
1ut4_A2e-544617419146NO APICAL MERISTEM PROTEIN
3swp_D2e-544617422149NAC domain-containing protein 19
3swp_C2e-544617422149NAC domain-containing protein 19
3swp_B2e-544617422149NAC domain-containing protein 19
3swp_A2e-544617422149NAC domain-containing protein 19
3swm_D2e-544617422149NAC domain-containing protein 19
3swm_C2e-544617422149NAC domain-containing protein 19
3swm_B2e-544617422149NAC domain-containing protein 19
3swm_A2e-544617422149NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197621e-165FR819762.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC012 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753810.11e-113PREDICTED: protein FEZ isoform X1
SwissprotQ9FIW52e-58NAC94_ARATH; Putative NAC domain-containing protein 94
SwissprotQ9ZVH08e-58FEZ_ARATH; Protein FEZ
TrEMBLM0YID01e-132M0YID0_HORVD; Uncharacterized protein
TrEMBLM0YID11e-132M0YID1_HORVD; Uncharacterized protein
STRINGMLOC_69621.21e-131(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.22e-88NAC domain containing protein 35